Administration

House COVID panel accuses Trump administration of exacerbating pandemic in final report

House COVID panel accuses Trump administration of exacerbating pandemic in final report

The House Special Subcommittee on the Coronavirus Crisis released its final report Friday before Republicans take control of the House in the next Congress, providing new findings on how the Trump administration’s actions had a negative impact on the American response. The report from the Democratic-led subcommittee, chaired by Rep. James Clyburn (SC), highlighted the …

House COVID panel accuses Trump administration of exacerbating pandemic in final report Read More »

Pharmaceutical Industry Regenerative Medicine Market Size, Share and Trend Analysis by Region, Drug Class, Route of Administration and Segment Forecast, 2022-2027

Pharmaceutical Industry Regenerative Medicine Market Size, Share and Trend Analysis by Region, Drug Class, Route of Administration and Segment Forecast, 2022-2027

NEW YORK, December 9, 2022 /PRNewswire/ — Pharmaceutical Industry Regenerative Medicine Market Size, Share and Trend Analysis by Region, Drug Class (Corticosteroids, Calcineurin Inhibitors, PDE4 Inhibitors, Biologics, Others), Route of Administration (Injectable, Oral, Topical) and Segment Forecast, 2022-2027 Read the full report: https://www.reportlinker.com/p06371494/?utm_source=PRN SummaryPharmacy regenerative medicine market size has been valued at US$29.4 billion in …

Pharmaceutical Industry Regenerative Medicine Market Size, Share and Trend Analysis by Region, Drug Class, Route of Administration and Segment Forecast, 2022-2027 Read More »

Assured Benefits Administrators Launch AI-Powered Smart Health Plan Administration Using Precision Intelligence from Health at Scale

Assured Benefits Administrators Launch AI-Powered Smart Health Plan Administration Using Precision Intelligence from Health at Scale

Collaborating to drive value-based care that improves health outcomes, costs, access, and equity for ABA client employers, powered by Health at Scale’s best-in-class artificial intelligence SAN JOSE, CA., December 5, 2022 /PRNewswire/ — Large Scale Healththe market leader in artificial intelligence for value-based care delivery, today announced a partnership with Assured Benefits Administrators (ABA), a …

Assured Benefits Administrators Launch AI-Powered Smart Health Plan Administration Using Precision Intelligence from Health at Scale Read More »

Intratracheal administration of a cocktail of trimerized nanobodies suppresses weight loss and prolongs survival in mice infected with SARS-CoV-2 – Communications Medicine

Production and trimerization of nanobodies Nanobodies targeting SARS-CoV-2 spike protein were selected as previously described12.13. N-terminal labeled tandem homotrimer PelB (MKYLLPTAAAGLLLLAAQPAMA) genes of the two-connected nanobody (GGGGS)4 linkers and 6 x C-terminal His-tag were synthesized and subcloned into the pMES4 vector. The exact amino acid sequences are as follows: TP17, MKYLLPTAAAGLLLLAAQPAMAQVQLQESGGGLVQAGGSLRLSCAASGRTSSVYNMAWFRQTPGKEREFVAAITGNGGTTLYADSVKGRLTISRGNAKNTVSLQMNVLKPDDTAVYYCAAGGWGKERNYAYWGQGTQVTVSSGGGGSGGGGSGGGGSGGGGSQVQLQESGGGLVQAGGSLRLSCAASGRTSSVYNMAWFRQTPGKEREFVAAITGNGGTTLYADSVKGRLTISRGNAKNTVSLQMNVLKPDDTAVYYCAAGGWGKERNYAYWGQGTQVTVSSGGGGSGGGGSGGGGSGGGGSQVQLQESGGGLVQAGGSLRLSCAASGRTSSVYNMAWFRQTPGKEREFVAAITGNGGTTLYADSVKGRLTISRGNAKNTVSLQMNVLKPDDTAVYYCAAGGWGKERNYAYWGQGTQVTVSSHHHHHH; TP86, MKYLLPTAAAGLLLLAAQPAMAMAQVQLQESGGGLVQAGGSLRLSCVASGRTFSSLNIVWFRQAPGKERKFVAAINDRNTAYAESVKGRFTISRDNAKNTVHLQMNSLKPEDTAVYYCHSADVNGGMDYWGKGTQVTVSSGGGGSGGGGSGGGGSGGGGSQVQLQESGGGLVQAGGSLRLSCVASGRTFSSLNIVWFRQAPGKERKFVAAINDRNTAYAESVKGRFTISRDNAKNTVHLQMNSLKPEDTAVYYCHSADVNGGMDYWGKGTQVTVSSGGGGSGGGGSGGGGSGGGGSQVQLQESGGGLVQAGGSLRLSCVASGRTFSSLNIVWFRQAPGKERKFVAAINDRNTAYAESVKGRFTISRDNAKNTVHLQMNSLKPEDTAVYYCHSADVNGGMDYWGKGTQVTVSSHHHHHH. These expression …

Intratracheal administration of a cocktail of trimerized nanobodies suppresses weight loss and prolongs survival in mice infected with SARS-CoV-2 – Communications Medicine Read More »

Biden administration releases policy protecting access to abortion for unaccompanied immigrant youth

Biden administration releases policy protecting access to abortion for unaccompanied immigrant youth

Chelsea Tejada, she/she, Legal Fellow, ACLU Reproductive Freedom Project Amid the chaos and devastation caused by the U.S. Supreme Court’s gutting of the constitutional right to abortion, the Biden administration has stepped up efforts to protect access to abortion for young immigrant women. pregnant unaccompanied. On November 10, 2022, the Office of Refugee Resettlement (ORR) …

Biden administration releases policy protecting access to abortion for unaccompanied immigrant youth Read More »

DJJ Secretary Simone Marstiller

Agency for Health Care Administration Secretary Simone Marstiller calls it quits

Secretary of the Agency for Health Care Administration (AHCA) Simone Martiller will step down, the first departure in what could be a busy transition for the newly re-elected governor. Ron DeSantis. DeSantis announced in a tweet Monday that Marstiller was leaving his administration. He said Marstiller “led the way in promoting transparency and accountability in …

Agency for Health Care Administration Secretary Simone Marstiller calls it quits Read More »

AG Derek Schmidt calls on Biden administration to repeal mandate to vaccinate healthcare workers - Newstalk KZRG

AG Derek Schmidt calls on Biden administration to repeal mandate to vaccinate healthcare workers – Newstalk KZRG

TOPEKA – (November 21, 2022) – Kansas Attorney General Derek Schmidt is calling on the Biden administration to withdraw its COVID-19 vaccine mandate for healthcare workers and all related guidelines, arguing that continued efforts to coerce compliance violate workers’ rights and state authority. Schmidt joined a coalition of 21 other attorneys general last week in …

AG Derek Schmidt calls on Biden administration to repeal mandate to vaccinate healthcare workers – Newstalk KZRG Read More »

Three women with raised fists, wearing masks with "BAN OFF OUR BODIES" printed on them and carrying a purple banner, lead other protestors at the Women's March Rally For Abortion Justice In Washington, D.C.

Biden administration releases policy protecting access to abortion for unaccompanied immigrant youth | News & Reviews | American Civil Liberties Union

Amid the chaos and devastation caused by the U.S. Supreme Court’s gutting of the constitutional right to abortion, the Biden administration has stepped up efforts to protect access to abortion for young immigrant women. pregnant unaccompanied. On November 10, 2022, the Office of Refugee Resettlement (ORR) announced new guidelines to ensure that unaccompanied immigrant minors …

Biden administration releases policy protecting access to abortion for unaccompanied immigrant youth | News & Reviews | American Civil Liberties Union Read More »

Judge Matthew J. Kacsmaryk during his Senate confirmation hearing in 2017.

Judge Trump rules against Biden administration on LGBTQ protections ACA

U.S. District Judge Matthew J. Kacsmaryk, a staunch foe of LGBTQ rights before being appointed to the U.S. District Court for the Northern District of Texas by President Donald Trump, ruled Nov. 11 that the Biden administration violated the Administrative Procedure Act (APA) and misinterpreted the Affordable Care Act (ACA) in 2021 when Health and …

Judge Trump rules against Biden administration on LGBTQ protections ACA Read More »

Alumni Panel to Highlight Career Opportunities in Health Policy and Administration |  Penn State University

Alumni Panel to Highlight Career Opportunities in Health Policy and Administration | Penn State University

HAZLETON, Pa. — Students interested in learning more about health policy internships and careers can hear from various industry professionals at a panel discussion hosted by the Penn State Health Policy and Administration Consortium from 6-7 p.m. 15 p.m. on Tuesday, November 1. 15, through Zoom. It is free and open to students at Penn …

Alumni Panel to Highlight Career Opportunities in Health Policy and Administration | Penn State University Read More »